Recruiting design partners for new verticals — open a new industry, get the platform at half price
Nexevo
Talk to sales

The Vertical AI Platform

Enterprise AI, built for your industry.

Deeply customized — every customer gets their own AI expert. You bring the requirements; we build it for you.

Talk to salesSign in
Agent

Plans, calls tools, and delivers multi-step work end to end — not just chat.

Private Memory

Your workspace remembers decisions and context — across models and sessions.

Projects

Instructions, knowledge files, and your team in one shared context.

Custom Skills

We distill your expertise into skills your AI executes consistently.

anthropicopenaigeminideepseekqwenmetamistralmoonshotminimaxdoubaohunyuancoherexaizhipunvidiavoyageanthropicopenaigeminideepseekqwenmetamistralmoonshotminimaxdoubaohunyuancoherexaizhipunvidiavoyage

One platform, three things done right

The pieces that turn a generic assistant into your team's expert.

Private Memory

Your workspace remembers what matters — decisions, preferences, domain context — and keeps it private to you.

Custom Skills

We distill your team's expertise into reusable skills your AI executes consistently, every time.

Vertical Service

Not a generic chatbot. Workflows engineered for your industry, co-built and refined with our team.

Core capabilities

A complete AI workbench, day one

Agent executes · Projects organize · Memory persists · Studio creates — one platform, one login.

Autonomous execution

Agent

Give Agent the goal — it plans, calls tools, searches, analyzes files, and delivers multi-step tasks end to end. Schedule it to run on a timer, inside your project's context.

  • 20+ built-in tools — search, files, code, data
  • Multi-step planning with self-check
  • Scheduled runs with project context injected
  • Live streaming with a full step audit trail
web_search1.2s
spreadsheet_analyze3.8s
create_pdf — quarterly summary
Plan: gather Q2 payment data → reconcile by corridor → draft the summary deck…
Team workspaces

Projects & Knowledge

A project carries your instructions, your knowledge files — PDF, Word, HTML, spreadsheets — and your team. Every chat and agent run inside it speaks your business.

  • Project instructions injected into every chat
  • Knowledge files: PDF, Word, HTML, text
  • Editor / viewer sharing, ownership transfer
  • Project-scoped schedules and agent runs

Cross-border payments desk

Always reconcile in USD; flag any corridor over 2% variance.

playbook.pdftariffs.xlsxfaq.md
ALM
3 members
Long-term memory

Private Memory

A unified memory layer across models and sessions. Decisions, preferences, and domain context are distilled automatically — switch models without losing who you are. Isolated per workspace, exportable, erasable.

  • Auto-distilled from real work, not manual notes
  • Semantic search across everything you've decided
  • Strict per-workspace isolation
  • Export or erase anytime — your data, owned
Settlement preference

Reports settle in USD, MT103 format.

Brand voice

Concise, no exclamation marks, English-first.

Compliance rule

PII must be redacted before export.

Multimodal studio

Generate

Images, video, and speech in the same workspace — flat per-unit pricing, no model menus to study. The agent can create them mid-task, too.

  • Text-to-image, text-to-video, text-to-speech
  • Flat per-image / per-second / per-1k-chars pricing
  • Durable storage with shareable links
  • Available to agents as tools

How it works

How it works

From first login to a working vertical AI in weeks, not quarters.

  1. 1

    Onboard your workspace

    Bring your team, your documents, and your context. Your workspace is isolated from day one.

  2. 2

    Co-build with us

    We work alongside your experts to encode your processes into skills and verticalized workflows.

  3. 3

    Deploy and own

    Roll out to your whole team. Your data, your memory, your skills — exportable anytime.

Industries

Your AI assistant, deeply customized

We go deep in one vertical at a time instead of shallow everywhere.

Now onboarding

AI Customer Service

Connect your FAQ, orders, and knowledge base. We co-build the workflows, guardrails, and evaluations; your private data stays isolated. Aim: 80% of common questions answered automatically.

Become a design partner

Financial Services

Payments operations, reconciliation, compliance reviews, and cross-border workflows.

Document Intelligence

Contracts, papers, manuals — extract key points, compare versions, and ask questions in plain language.

Enterprise Knowledge RAG

One index across wikis, tickets, and docs — employees ask in natural language, answers come with sources.

Legal & Compliance

Contract review, regulatory monitoring, and policy drafting with auditable output.

More coming

Your industry next? We onboard design partners one vertical at a time.

Trust & security

Enterprise-grade by default

Data residency

Your data stays in your chosen region.

Workspace isolation

Strict per-workspace boundaries across storage, memory, and skills.

BYOK & export anytime

Bring your own provider keys, and take your data with you whenever you want.

GDPR-ready

Deletion, export, and consent workflows are part of the platform, not an afterthought.

Your prompts and outputs are never used to train foundation models — ours or anyone else's.

Become a design partner

We onboard one vertical at a time — your industry could be next. From scoping call to working AI in weeks.

Talk to salesSign in